Structure of PDB 8z9c Chain C Binding Site BS01

Receptor Information
>8z9c Chain C (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z9c Chain M (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguu
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z9c Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		G21 K28 F37 R40 K52 G53 R56 S57 T73 P80 G91 S92 M93 A96 T118 H119 L120 R121 I122 R124 K127 D131 F133 G174 G175 W176 N178
Binding residue
(residue number reindexed from 1)		G20 K27 F36 R39 K51 G52 R55 S56 T72 P79 G90 S91 M92 A95 T117 H118 L119 R120 I121 R123 K126 D130 F132 G173 G174 W175 N177
External links