Structure of PDB 8z4l Chain C Binding Site BS01

Receptor Information
>8z4l Chain C (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z4l Chain M (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuu
.................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4l Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G21 K28 F37 R40 P50 K52 G53 R56 S57 G91 S92 M93 A96 G97 T118 H119 L120 R121 I122 R124 K127 D131 F133 G174 G175 W176 L177 N178 K179
Binding residue
(residue number reindexed from 1)		G20 K27 F36 R39 P49 K51 G52 R55 S56 G90 S91 M92 A95 G96 T117 H118 L119 R120 I121 R123 K126 D130 F132 G173 G174 W175 L176 N177 K178
External links