Structure of PDB 8yfl Chain C Binding Site BS01

Receptor Information
>8yfl Chain C (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLK
PRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yfl Structural basis for TNIP1 binding to FIP200 during mitophagy.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		E1563 Y1564 C1565 Q1566 A1567 K1568 K1569 N1572 R1573 F1574 R1584
Binding residue
(residue number reindexed from 1)		E64 Y65 C66 Q67 A68 K69 K70 N73 R74 F75 R85
External links
PDB RCSB:8yfl, PDBe:8yfl, PDBj:8yfl
PDBsum8yfl
PubMed39059492
UniProtQ8TDY2|RBCC1_HUMAN RB1-inducible coiled-coil protein 1 (Gene Name=RB1CC1)

[Back to BioLiP]