Structure of PDB 8yfk Chain C Binding Site BS01

Receptor Information
>8yfk Chain C (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPR
RPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yfk Structural basis for TNIP1 binding to FIP200 during mitophagy.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E1563 Y1564 C1565 Q1566 A1567 K1568 K1569 R1573 F1574 R1584
Binding residue
(residue number reindexed from 1)		E62 Y63 C64 Q65 A66 K67 K68 R72 F73 R83
External links
PDB RCSB:8yfk, PDBe:8yfk, PDBj:8yfk
PDBsum8yfk
PubMed39059492
UniProtQ8TDY2|RBCC1_HUMAN RB1-inducible coiled-coil protein 1 (Gene Name=RB1CC1)

[Back to BioLiP]