Structure of PDB 8ugq Chain C Binding Site BS01

Receptor Information

>8ugq Chain C (length=213) Species: 10823 (Maize streak virus - [Nigeria]) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHTSE
TLTYKIAIDYHFVADAAACRYSNTGTGVMWLVYDTTPGGQAPTPQTIFAY
PDTLKAWPATWKVSRELCHRFVVKRRWLFNMETDGRIGSDIPPSNASWKP
CKRNIYFHKFTSGLGVRTQWKNVTDGGVGAIQRGALYMVIAPGNGLTFTA
HGQTRLYFKSVGN

Ligand information

>8ugq Chain M (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgaacccca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ugq The two states of Maize Streak Virus (MSV) Geminivirus Architecture
Resolution	3.17 Å
Binding residue (original residue number in PDB)	K34 K142 R145 H149 V153
Binding residue (residue number reindexed from 1)	K4 K112 R115 H119 V123

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005198	structural molecule activity

	Biological Process
GO:0046718	symbiont entry into host cell
GO:0075732	viral penetration into host nucleus

	Cellular Component
GO:0019028	viral capsid
GO:0039615	T=1 icosahedral viral capsid
GO:0042025	host cell nucleus
GO:0043657	host cell

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ugq, PDBe:8ugq, PDBj:8ugq
PDBsum	8ugq
PubMed
UniProt	P06448\|CAPSD_MSVN Capsid protein (Gene Name=V1)

[Back to BioLiP]