Structure of PDB 8tit Chain C Binding Site BS01

Receptor Information

>8tit Chain C (length=210) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGICEIHVAKYAEIF
GLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVHIN
PYLIPFFIGRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKI
DWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQT
THIVFSFRDI

Ligand information

>8tit Chain A (length=31) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccggacctgtgacaaattgccctcagacgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8tit Towards automated crystallographic structure refinement with phenix.refine.
Resolution	2.84 Å
Binding residue (original residue number in PDB)	R33 E77 R200 M201 P202 R205 R206 R233 Q234
Binding residue (residue number reindexed from 1)	R19 E56 R165 M166 P167 R170 R171 R198 Q199

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8tit, PDBe:8tit, PDBj:8tit
PDBsum	8tit
PubMed
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]