Structure of PDB 8tis Chain C Binding Site BS01

Receptor Information
>8tis Chain C (length=211) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVH
INPYLIPFFIRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLK
IDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQ
TTHIVFSFRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tis Towards automated crystallographic structure refinement with phenix.refine.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R33 E77 R124 R200 M201 P202 R205 R206 Q234
Binding residue
(residue number reindexed from 1)		R20 E58 R94 R166 M167 P168 R171 R172 Q200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8tis, PDBe:8tis, PDBj:8tis
PDBsum8tis
PubMed
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]