Structure of PDB 8tir Chain C Binding Site BS01

Receptor Information
>8tir Chain C (length=212) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAE
IFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAHSPSRGLYSVH
INPYLIPFFINRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSL
KIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGR
QTTHIVFSFRDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tir Towards automated crystallographic structure refinement with phenix.refine.
Resolution3.11 Å
Binding residue
(original residue number in PDB)
R33 E77 R200 M201 P202 R205 R206 R233 Q234
Binding residue
(residue number reindexed from 1)
R20 E58 R167 M168 P169 R172 R173 R200 Q201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8tir, PDBe:8tir, PDBj:8tir
PDBsum8tir
PubMed
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]