Structure of PDB 8t9h Chain C Binding Site BS01

Receptor Information
>8t9h Chain C (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPK
Ligand information
>8t9h Chain I (length=99) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctcaattggtcgtagacagctctagcaccgcttaaacgcacgtacggat
tctcccccgcgttttaaccgccaaggggattactccctagtctccaggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t9h Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1
Resolution3.37 Å
Binding residue
(original residue number in PDB)		R42 V43 G44 A45
Binding residue
(residue number reindexed from 1)		R31 V32 G33 A34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8t9h, PDBe:8t9h, PDBj:8t9h
PDBsum8t9h
PubMed36993485
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]