Structure of PDB 8t9d Chain C Binding Site BS01

Receptor Information
>8t9d Chain C (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLE
HLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQA
PDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHKAKRKEEPSS
IFQRQRVDALLLDLRQKFPPKFVQLKPG
Ligand information
>8t9d Chain 9 (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YYKFPKKKDVEFLPPQLPSDKFKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t9d An IDR-dependent mechanism for nuclear receptor control of Mediator interaction with RNA polymerase II.
Resolution4.66 Å
Binding residue
(original residue number in PDB)		S170 I171 K196
Binding residue
(residue number reindexed from 1)		S150 I151 K176
Gene Ontology
Molecular Function
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0016567 protein ubiquitination
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0035019 somatic stem cell population maintenance
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016020 membrane
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8t9d, PDBe:8t9d, PDBj:8t9d
PDBsum8t9d
PubMed38955181
UniProtO75586|MED6_HUMAN Mediator of RNA polymerase II transcription subunit 6 (Gene Name=MED6)

[Back to BioLiP]