Structure of PDB 8suv Chain C Binding Site BS01

Receptor Information
>8suv Chain C (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLK
MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYS
LAKEQRLNFGDDIPSALRIAKKKRWNSI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8suv Interaction with the membrane-anchored protein CHIC2 constrains the ubiquitin ligase activity of CHIP
Resolution1.63 Å
Binding residue
(original residue number in PDB)
K30 N34 F37 Y49 V61 N65 L68 K95 F98 Q102 F131 D134
Binding residue
(residue number reindexed from 1)
K8 N12 F15 Y27 V39 N43 L46 K73 F76 Q80 F109 D112
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8suv, PDBe:8suv, PDBj:8suv
PDBsum8suv
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]