Structure of PDB 8sro Chain C Binding Site BS01

Receptor Information
>8sro Chain C (length=86) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRN
HPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sro FoxP3 tetramer on TTTG repeats
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R337 T341 Y342 T380
Binding residue
(residue number reindexed from 1)		R11 T15 Y16 T54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8sro, PDBe:8sro, PDBj:8sro
PDBsum8sro
PubMed38030726
UniProtQ99JB6|FOXP3_MOUSE Forkhead box protein P3 (Gene Name=Foxp3)

[Back to BioLiP]