Structure of PDB 8sps Chain C Binding Site BS01

Receptor Information
>8sps Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNI
QAVLLPK
Ligand information
>8sps Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cctccccatgtgggacctggagaaacagagggtggagggagcatagagag
tctgttctaagctgcaaagcaaaggcctggcgacctaggagaccatggag
ttccagaaagtgatagttatgcagagcgaatggagggaatcagcacg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sps Structural mechanism of LIN28B nucleosome targeting by OCT4.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S16 R17 R20 G28 R32
Binding residue
(residue number reindexed from 1)		S5 R6 R9 G17 R21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8sps, PDBe:8sps, PDBj:8sps
PDBsum8sps
PubMed37327775
UniProtQ16777|H2A2C_HUMAN Histone H2A type 2-C (Gene Name=H2AC20)

[Back to BioLiP]