Structure of PDB 8sm5 Chain C Binding Site BS01

Receptor Information
>8sm5 Chain C (length=155) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYH
VLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRA
LAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWS
TLIED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sm5 Epstein-Barr Virus Encoded BCL2, BHRF1, Downregulates Autophagy by Noncanonical Binding of BECN1.
Resolution2.61003 Å
Binding residue
(original residue number in PDB)
N61 T68 R71 H75 S85 V86 I90 G99 R100 L102 W107
Binding residue
(residue number reindexed from 1)
N60 T67 R70 H74 S84 V85 I89 G98 R99 L101 W106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8sm5, PDBe:8sm5, PDBj:8sm5
PDBsum8sm5
PubMed37776275
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]