Structure of PDB 8rjw Chain C Binding Site BS01

Receptor Information
>8rjw Chain C (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINL
ANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDV
GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rjw Mechanism of single-stranded DNA annealing by RAD52-RPA complex
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R55 Y65 R153
Binding residue
(residue number reindexed from 1)		R31 Y41 R129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006312 mitotic recombination
GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
GO:0034599 cellular response to oxidative stress
GO:0045002 double-strand break repair via single-strand annealing
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0032991 protein-containing complex
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rjw, PDBe:8rjw, PDBj:8rjw
PDBsum8rjw
PubMed38658755
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]