Structure of PDB 8r8r Chain C Binding Site BS01

Receptor Information
>8r8r Chain C (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMC
PFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGEC
SNKECPFLHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r8r Molecular basis of human polyA polymerase recruitment by mPSF.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		C68 K69 H70 L75 K77 F84 F98 S106 F112
Binding residue
(residue number reindexed from 1)		C63 K64 H65 L70 K72 F79 F93 S101 F107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r8r, PDBe:8r8r, PDBj:8r8r
PDBsum8r8r
PubMed38538052
UniProtO95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 (Gene Name=CPSF4)

[Back to BioLiP]