Structure of PDB 8r3k Chain C Binding Site BS01

Receptor Information
>8r3k Chain C (length=249) Species: 1318616 (Influenza A virus (A/Zhejiang/DTID-ZJU01/2013(H7N9))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM
MAMKYPITADKRIMEMIPERNEQRQTLWSKTNDAGSDRVMVSPLAVTWWN
RNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPG
HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKKELQDCKIAP
LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGE
Ligand information
>8r3k Chain V (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aguagaaacaaggguguauuuuccccucuuu
.<<....>>......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r3k The host RNA polymerase II C-terminal domain is the anchor for replication of the influenza virus genome.
Resolution3.43 Å
Binding residue
(original residue number in PDB)		R38 K41 N82 D83 A84 R88 Y205 R216
Binding residue
(residue number reindexed from 1)		R38 K41 N82 D83 A84 R88 Y205 R216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0039694 viral RNA genome replication
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r3k, PDBe:8r3k, PDBj:8r3k
PDBsum8r3k
PubMed38316757
UniProtX5F427

[Back to BioLiP]