Structure of PDB 8r2g Chain C Binding Site BS01

Receptor Information
>8r2g Chain C (length=236) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGK
TQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHD
AVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVD
FSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTHILAHASTTRI
SLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r2g Crystal structure of a BRCA2-DMC1 complex
Resolution3.45 Å
Binding residue
(original residue number in PDB)		Q144 G153 G154 N178 V179 N187 E213
Binding residue
(residue number reindexed from 1)		Q62 G71 G72 N96 V97 N105 E131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0007131 reciprocal meiotic recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r2g, PDBe:8r2g, PDBj:8r2g
PDBsum8r2g
PubMed
UniProtQ14565|DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog (Gene Name=DMC1)

[Back to BioLiP]