Structure of PDB 8r1f Chain C Binding Site BS01

Receptor Information
>8r1f Chain C (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT
CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAP
PQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLR
KK
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain8r1f Chain C Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r1f Monomeric E6AP-E6-p53 ternary complex
Resolution3.67 Å
Binding residue
(original residue number in PDB)		C176 H179 C242
Binding residue
(residue number reindexed from 1)		C86 H89 C152
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0001094 TFIID-class transcription factor complex binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002020 protease binding
GO:0002039 p53 binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003700 DNA-binding transcription factor activity
GO:0003730 mRNA 3'-UTR binding
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0019899 enzyme binding
GO:0030971 receptor tyrosine kinase binding
GO:0031625 ubiquitin protein ligase binding
GO:0035033 histone deacetylase regulator activity
GO:0036310 ATP-dependent DNA/DNA annealing activity
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0051087 protein-folding chaperone binding
GO:0051721 protein phosphatase 2A binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0071889 14-3-3 protein binding
GO:0097371 MDM2/MDM4 family protein binding
GO:0097718 disordered domain specific binding
GO:0140296 general transcription initiation factor binding
GO:0140677 molecular function activator activity
GO:0140693 molecular condensate scaffold activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000423 mitophagy
GO:0001701 in utero embryonic development
GO:0001756 somitogenesis
GO:0001836 release of cytochrome c from mitochondria
GO:0002244 hematopoietic progenitor cell differentiation
GO:0002309 T cell proliferation involved in immune response
GO:0002326 B cell lineage commitment
GO:0002360 T cell lineage commitment
GO:0002931 response to ischemia
GO:0006289 nucleotide-excision repair
GO:0006302 double-strand break repair
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006606 protein import into nucleus
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0006979 response to oxidative stress
GO:0006983 ER overload response
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007265 Ras protein signal transduction
GO:0007346 regulation of mitotic cell cycle
GO:0007369 gastrulation
GO:0007405 neuroblast proliferation
GO:0007406 negative regulation of neuroblast proliferation
GO:0007417 central nervous system development
GO:0007507 heart development
GO:0007623 circadian rhythm
GO:0008104 protein localization
GO:0008156 negative regulation of DNA replication
GO:0008283 cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0008340 determination of adult lifespan
GO:0009299 mRNA transcription
GO:0009303 rRNA transcription
GO:0009410 response to xenobiotic stimulus
GO:0009411 response to UV
GO:0009651 response to salt stress
GO:0009792 embryo development ending in birth or egg hatching
GO:0010165 response to X-ray
GO:0010332 response to gamma radiation
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0010659 cardiac muscle cell apoptotic process
GO:0010666 positive regulation of cardiac muscle cell apoptotic process
GO:0014009 glial cell proliferation
GO:0016032 viral process
GO:0019661 glucose catabolic process to lactate via pyruvate
GO:0021549 cerebellum development
GO:0030308 negative regulation of cell growth
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0031571 mitotic G1 DNA damage checkpoint signaling
GO:0032211 negative regulation of telomere maintenance via telomerase
GO:0033077 T cell differentiation in thymus
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0033554 cellular response to stress
GO:0034103 regulation of tissue remodeling
GO:0034644 cellular response to UV
GO:0035264 multicellular organism growth
GO:0035794 positive regulation of mitochondrial membrane permeability
GO:0042127 regulation of cell population proliferation
GO:0042149 cellular response to glucose starvation
GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043153 entrainment of circadian clock by photoperiod
GO:0043504 mitochondrial DNA repair
GO:0043516 regulation of DNA damage response, signal transduction by p53 class mediator
GO:0043523 regulation of neuron apoptotic process
GO:0043525 positive regulation of neuron apoptotic process
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045861 negative regulation of proteolysis
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045899 positive regulation of RNA polymerase II transcription preinitiation complex assembly
GO:0045930 negative regulation of mitotic cell cycle
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046677 response to antibiotic
GO:0048144 fibroblast proliferation
GO:0048147 negative regulation of fibroblast proliferation
GO:0048511 rhythmic process
GO:0048512 circadian behavior
GO:0048539 bone marrow development
GO:0048568 embryonic organ development
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
GO:0050821 protein stabilization
GO:0051097 negative regulation of helicase activity
GO:0051262 protein tetramerization
GO:0051276 chromosome organization
GO:0051402 neuron apoptotic process
GO:0051726 regulation of cell cycle
GO:0060218 hematopoietic stem cell differentiation
GO:0060253 negative regulation of glial cell proliferation
GO:0060333 type II interferon-mediated signaling pathway
GO:0060411 cardiac septum morphogenesis
GO:0062100 positive regulation of programmed necrotic cell death
GO:0065003 protein-containing complex assembly
GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070242 thymocyte apoptotic process
GO:0070243 regulation of thymocyte apoptotic process
GO:0070245 positive regulation of thymocyte apoptotic process
GO:0070266 necroptotic process
GO:0071456 cellular response to hypoxia
GO:0071466 cellular response to xenobiotic stimulus
GO:0071479 cellular response to ionizing radiation
GO:0071480 cellular response to gamma radiation
GO:0071494 cellular response to UV-C
GO:0072089 stem cell proliferation
GO:0072331 signal transduction by p53 class mediator
GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
GO:0072593 reactive oxygen species metabolic process
GO:0072717 cellular response to actinomycin D
GO:0090200 positive regulation of release of cytochrome c from mitochondria
GO:0090398 cellular senescence
GO:0090399 replicative senescence
GO:0090403 oxidative stress-induced premature senescence
GO:0097193 intrinsic apoptotic signaling pathway
GO:0097252 oligodendrocyte apoptotic process
GO:1900119 positive regulation of execution phase of apoptosis
GO:1901525 negative regulation of mitophagy
GO:1902108 regulation of mitochondrial membrane permeability involved in apoptotic process
GO:1902253 regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:1902749 regulation of cell cycle G2/M phase transition
GO:1902895 positive regulation of miRNA transcription
GO:1903451 negative regulation of G1 to G0 transition
GO:1903799 negative regulation of miRNA processing
GO:1904024 negative regulation of glucose catabolic process to lactate via pyruvate
GO:1905856 negative regulation of pentose-phosphate shunt
GO:1990144 intrinsic apoptotic signaling pathway in response to hypoxia
GO:2000269 regulation of fibroblast apoptotic process
GO:2000378 negative regulation of reactive oxygen species metabolic process
GO:2000379 positive regulation of reactive oxygen species metabolic process
GO:2000647 negative regulation of stem cell proliferation
GO:2000772 regulation of cellular senescence
GO:2000774 positive regulation of cellular senescence
GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005667 transcription regulator complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005783 endoplasmic reticulum
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0016363 nuclear matrix
GO:0016604 nuclear body
GO:0016605 PML body
GO:0017053 transcription repressor complex
GO:0032991 protein-containing complex
GO:0035861 site of double-strand break
GO:0043073 germ cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r1f, PDBe:8r1f, PDBj:8r1f
PDBsum8r1f
PubMed
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]