Structure of PDB 8qqf Chain C Binding Site BS01

Receptor Information
>8qqf Chain C (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFMDRKEVVNIQTWINKPDIKHHFPCKEVKESGHMFPSHLLVTATHMYCL
REILSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSIEILAIERY
LIPNAGDATRAIKQQIMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qqf Cargo selective vesicle tethering: The structural basis for binding of specific cargo proteins by the Golgi tether component TBC1D23.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		V626 V627 K628 I629 T630 S631 K632 K633 K672 I675
Binding residue
(residue number reindexed from 1)		V71 V72 K73 I74 T75 S76 K77 K78 K113 I116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042147 retrograde transport, endosome to Golgi

View graph for
Biological Process
External links
PDB RCSB:8qqf, PDBe:8qqf, PDBj:8qqf
PDBsum8qqf
PubMed38552021
UniProtQ9NUY8|TBC23_HUMAN TBC1 domain family member 23 (Gene Name=TBC1D23)

[Back to BioLiP]