Structure of PDB 8ptj Chain C Binding Site BS01

Receptor Information
>8ptj Chain C (length=174) Species: 1549864 (Tilapia lake virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQFGKSFKGRTEVTITEYRSHTVRSLLTADKSLRKSFCFRNALNQFLDKD
LPLLPIRPKLESRVAVKKSKLRSQLSFRPGLTQEEAIDLYNKGYDGDSVS
GALQDRVVNEPVAYSSADNDKFHRGLAALGYTLAKAKVTVLSRSKWMGYE
DLPQKPPNGTFYCRKRKAMLLISC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ptj Structural and functional analysis of the minimal orthomyxovirus-like polymerase of Tilapia Lake Virus from the highly diverged Amnoonviridae family.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		D35 K36 R39 K40 S41 F42
Binding residue
(residue number reindexed from 1)		D30 K31 R34 K35 S36 F37
Enzymatic activity
Enzyme Commision number ?
External links