Structure of PDB 8pt7 Chain C Binding Site BS01

Receptor Information
>8pt7 Chain C (length=139) Species: 1549864 (Tilapia lake virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQFGKSFKGRTEVTITEYRSHTVKDVHRSLLTADKSLRKSFCFRNALNQ
FLDKDLPLLPIRPKLESRVAVKKSKLRSQLSFRPGLTQEEAIDLYNKGYD
GDSVSGALQDRVVNEPVAYSSADNDKFHRGLAALGYTLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pt7 Structural and functional analysis of the minimal orthomyxovirus-like polymerase of Tilapia Lake Virus from the highly diverged Amnoonviridae family.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R29 L31 T33
Binding residue
(residue number reindexed from 1)		R29 L31 T33
Enzymatic activity
Enzyme Commision number ?
External links