Structure of PDB 8pfe Chain C Binding Site BS01

Receptor Information
>8pfe Chain C (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFKCMKALGMESGKIHSKQITASSQYSTNWSAERSRLNYPENGWTPGEDS
YREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGKDWIT
IEEGNKPVLFQGNTNPTDVVVAVFPEPLITRFVRIKPATWETGISMRFEV
YGCKIT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pfe New Crystal Form of Human Neuropilin-1 b1 Fragment with Six Electrostatic Mutations Complexed with KDKPPR Peptide Ligand.
Resolution1.35 Å
Binding residue
(original residue number in PDB)
Y297 W301 T316 D320 S346 E348 T349 Y353 G414 I415
Binding residue
(residue number reindexed from 1)
Y26 W30 T45 D49 S75 E77 T78 Y82 G143 I144
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8pfe, PDBe:8pfe, PDBj:8pfe
PDBsum8pfe
PubMed37513474
UniProtO14786|NRP1_HUMAN Neuropilin-1 (Gene Name=NRP1)

[Back to BioLiP]