Structure of PDB 8ou0 Chain C Binding Site BS01

Receptor Information

>8ou0 Chain C (length=153) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNEVKESLRSVEQKYKIFQQQQFTFIGALEHCRENAHDKIRPISSIGQVQ
SYMEHHCSNSTDRRILLMFLDICSELSKLCQHFEALHPVTNNLLEKCKTL
VSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPIILDLMKEWVA
HSE

Ligand information

>8ou0 Chain D (length=20) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VPLEDLTNYKMSYVAHPLEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ou0 Structural specializations of the sperm tail.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	Y118 H125
Binding residue (residue number reindexed from 1)	Y114 H121

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008017	microtubule binding
GO:0048306	calcium-dependent protein binding

	Biological Process
GO:0030317	flagellated sperm motility
GO:0035082	axoneme assembly

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005737	cytoplasm
GO:0005879	axonemal microtubule
GO:0005881	cytoplasmic microtubule
GO:0036064	ciliary basal body
GO:0036126	sperm flagellum
GO:0097546	ciliary base
GO:0160110	axonemal microtubule doublet inner sheath

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ou0, PDBe:8ou0, PDBj:8ou0
PDBsum	8ou0
PubMed	37327785
UniProt	A0A3Q1MYU9

[Back to BioLiP]