Structure of PDB 8oni Chain C Binding Site BS01

Receptor Information
>8oni Chain C (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVRLQQSGPELVKPGASLKISCKASGYTFTDYNIHWLRQSHSKSLEWIGS
IYPYNGRPGYNQKFKNKTTLTVDNSSSTAYMELRGLTSDDSAVYFCARSR
SYYNGSRDYWGQGTSLTVSSAKTTPPSVYPLAPGMVTLGCLVKGYFPEPV
TVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHP
ASSTKVDKKIVP
Ligand information
>8oni Chain F (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oni Macromolecular structure of insulin and IgE clonality impacts IgE-mediated activation of sensitized basophils
Resolution2.3 Å
Binding residue
(original residue number in PDB)
N33 H35 W47 Y52 G59 S99 R100 S101 Y102
Binding residue
(residue number reindexed from 1)
N33 H35 W47 Y52 G59 S99 R100 S101 Y102
External links