Structure of PDB 8ol1 Chain C Binding Site BS01

Receptor Information
>8ol1 Chain C (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLP
Ligand information
>8ol1 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ol1 Nuclear degradation of cGAS is essential for immune homeostasis
Resolution3.5 Å
Binding residue
(original residue number in PDB)
R11 A12 A14 K15 T16 R17 R20 R32 R42 R77
Binding residue
(residue number reindexed from 1)
R2 A3 A5 K6 T7 R8 R11 R23 R33 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:8ol1, PDBe:8ol1, PDBj:8ol1
PDBsum8ol1
PubMed38418882
UniProtQ96KK5|H2A1H_HUMAN Histone H2A type 1-H (Gene Name=H2AC12)

[Back to BioLiP]