Structure of PDB 8odt Chain C Binding Site BS01

Receptor Information
>8odt Chain C (length=230) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAE
AFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHA
PEAVVEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIM
HAFIALGAVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVN
KLELNYDNFMEEFTAILHRQAFTVSESNKG
Ligand information
>8odt Chain F (length=21) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
INIVPLLDVLLVLLLIFMATA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8odt Tuneable force-transduction in the bacterial periplasm
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Y139 L142 F153 L156 A162 T163 L164 V167 I171 V189
Binding residue
(residue number reindexed from 1)		Y139 L142 F153 L156 A162 T163 L164 V167 I171 V189
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0017038 protein import
GO:0043213 bacteriocin transport
GO:0051301 cell division
GO:0090529 cell septum assembly
GO:1905153 regulation of membrane invagination
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030313 cell envelope
GO:0032153 cell division site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8odt, PDBe:8odt, PDBj:8odt
PDBsum8odt
PubMed37972066
UniProtP0ABU9|TOLQ_ECOLI Tol-Pal system protein TolQ (Gene Name=tolQ)

[Back to BioLiP]