Structure of PDB 8khu Chain C Binding Site BS01

Receptor Information
>8khu Chain C (length=141) Species: 10410 (Hepatitis B virus adw/991) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
LWFHISCLTFGRETVLEYLVSFGVWIRTPPAARPPNAPILS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8khu Discovery of 4,5,6,7-Tetrahydropyrazolo[1.5-a]pyrizine Derivatives as Core Protein Allosteric Modulators (CpAMs) for the Inhibition of Hepatitis B Virus.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H47 P50
Binding residue
(residue number reindexed from 1)		H47 P50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity

View graph for
Molecular Function
External links
PDB RCSB:8khu, PDBe:8khu, PDBj:8khu
PDBsum8khu
PubMed37801325
UniProtP03147|CAPSD_HBVD1 Capsid protein (Gene Name=C)

[Back to BioLiP]