Structure of PDB 8jrk Chain C Binding Site BS01

Receptor Information
>8jrk Chain C (length=178) Species: 29078 (Eptesicus fuscus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDHVIIQAEFFMEPDLTGEFMFDFDGDEIFHVDMQKKETVWRLEEFGKFA
SFEAQGALANIAVDKANLETMMKRSNYTPNTNVPPEMTVFPNKAVELGEP
NILICFIDKFSPPVLNVTWLQNGKPVTTGVSETVFLPREDHLFRKFYYLP
FLPSNEDVYDCKVEHWGLEEPLIKHWEF
Ligand information
>8jrk Chain F (length=13) Species: 11137 (Human coronavirus 229E) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NDILSRLDPPEAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jrk Crystal structure of the bat MHC II molecule at 2.3 A resolution
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q9 F24 W43 F51 A52 S53 F54 N62 V65 N69 T72 R76
Binding residue
(residue number reindexed from 1)		Q7 F22 W41 F49 A50 S51 F52 N60 V63 N67 T70 R74
External links