Structure of PDB 8jfu Chain C Binding Site BS01

Receptor Information
>8jfu Chain C (length=140) Species: 53344 (Staphylococcus delphini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMRKTIERLLNSELSSNSIAVRTGVSQAVISKLRNGKKELGNLTLNSAEK
LFEYQKEMEKVDTWIVYRGRTADMNKSYIAEGSTYEEVYNNFVDKYGYDV
LDEDIYEIQLLKKLEDYDYRELFENSSSQVYYHEFEITHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jfu AcrIIA15 in complex with palindromic DNA substrate
Resolution3.15 Å
Binding residue
(original residue number in PDB)		S25 K37 N41 L42 T43 S46
Binding residue
(residue number reindexed from 1)		S26 K38 N42 L43 T44 S47
External links