Structure of PDB 8j91 Chain C Binding Site BS01

Receptor Information
>8j91 Chain C (length=91) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSRSSKAGLQFPVGRIARFLKNGKYATRVGAGAPVYLAAVLEYLAAEVLE
LAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANG
Ligand information
>8j91 Chain I (length=113) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgca
cgtacgcgctgtcccccgcgttttaaccgccaaggggattactccctagt
ctccaggcacgtg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j91 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T16 S17 R18 R33 R78
Binding residue
(residue number reindexed from 1)		T1 S2 R3 R18 R63
Gene Ontology
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j91, PDBe:8j91, PDBj:8j91
PDBsum8j91
PubMed38992002
UniProtQ9LHQ5|H2A2_ARATH Probable histone H2A.2 (Gene Name=At3g20670)

[Back to BioLiP]