Structure of PDB 8j90 Chain C Binding Site BS01

Receptor Information
>8j90 Chain C (length=88) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLELA
GNAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAH
Ligand information
>8j90 Chain I (length=111) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacg
cacgtacgcgctgtcccccgcgttttaaccgccaaggggattactcccta
gtctccaggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j90 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution4.71 Å
Binding residue
(original residue number in PDB)		K26 K29 G37 R41 R86
Binding residue
(residue number reindexed from 1)		K1 K4 G12 R16 R61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
Biological Process
GO:0070828 heterochromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005730 nucleolus
GO:0009506 plasmodesma
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j90, PDBe:8j90, PDBj:8j90
PDBsum8j90
PubMed38992002
UniProtQ9FJE8|H2A7_ARATH Probable histone H2A.7 (Gene Name=At5g59870)

[Back to BioLiP]