Structure of PDB 8j62 Chain C Binding Site BS01

Receptor Information
>8j62 Chain C (length=127) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKIS
SEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPDL
ADQLIHLHYFKPPLPSVRKLTEDRWNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j62 Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R15 M16 R17 T20 R23 L24 P49 K50 W70 L72 H73 S165 K168 L169 R173
Binding residue
(residue number reindexed from 1)		R13 M14 R15 T18 R21 L22 P47 K48 W68 L70 H71 S116 K119 L120 R124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019058 viral life cycle

View graph for
Biological Process
External links
PDB RCSB:8j62, PDBe:8j62, PDBj:8j62
PDBsum8j62
PubMed37419875
UniProtP12504|VIF_HV1N5 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]