Structure of PDB 8iss Chain C Binding Site BS01

Receptor Information
>8iss Chain C (length=257) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPL
LLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSAL
AAEARETRRQELLEKITEGQAAKKQKPRSALLVQLATARPRPVKARPLDW
RVQSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPL
RFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQPDGKVVYT
SLQWASL
Ligand information
>8iss Chain E (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcucuguggcgcaauggauagcgcauuggacuucuagagagcaauucaa
agguuguggguucgaaucccaccagagucg
<<<<<<<..<<<<........>>>>.<<<<.<<<.....>>>....>>>>
.....<<<<<.......>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iss Recognition and cleavage mechanism of intron-containing pre-tRNA by human TSEN endonuclease complex.
Resolution3.19 Å
Binding residue
(original residue number in PDB)		R41 Q42 R108 I116 G119 Q120 K123 K239 L245 Y247 H255 R279 T282 V284 R285 K286 W306
Binding residue
(residue number reindexed from 1)		R41 Q42 R108 I116 G119 Q120 K123 K187 L193 Y195 H203 R227 T230 V232 R233 K234 W254
Enzymatic activity
Enzyme Commision number 4.6.1.16: tRNA-intron lyase.
Gene Ontology
Molecular Function
GO:0000213 tRNA-intron endonuclease activity
GO:0003676 nucleic acid binding
GO:0016829 lyase activity
Biological Process
GO:0000379 tRNA-type intron splice site recognition and cleavage
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
GO:0006397 mRNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0000214 tRNA-intron endonuclease complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iss, PDBe:8iss, PDBj:8iss
PDBsum8iss
PubMed37770519
UniProtQ9BSV6|SEN34_HUMAN tRNA-splicing endonuclease subunit Sen34 (Gene Name=TSEN34)

[Back to BioLiP]