Structure of PDB 8ike Chain C Binding Site BS01

Receptor Information
>8ike Chain C (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPATILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQ
RAKMKKLARR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ike Structural insights into the recognition of the A/T-rich motif in target gene promoters by the LMX1a homeobox domain
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K219 R222 Q244 R247 K251
Binding residue
(residue number reindexed from 1)		K23 R26 Q48 R51 K55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ike, PDBe:8ike, PDBj:8ike
PDBsum8ike
PubMed
UniProtQ8TE12|LMX1A_HUMAN LIM homeobox transcription factor 1-alpha (Gene Name=LMX1A)

[Back to BioLiP]