Structure of PDB 8igr Chain C Binding Site BS01

Receptor Information
>8igr Chain C (length=74) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLL
AVLEWGVVDDDMARLARQVAAILT
Ligand information
>8igr Chain N (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cctcgttgcgtttgtttgcacgaaccatatgtaagtatttccttagataa
caattgattga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8igr Structural basis of lambda CII-dependent transcription activation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T26 E27 K28 K37 S41 R42 K44
Binding residue
(residue number reindexed from 1)		T21 E22 K23 K32 S36 R37 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0019042 viral latency

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8igr, PDBe:8igr, PDBj:8igr
PDBsum8igr
PubMed37269829
UniProtP03042|RPC2_LAMBD Transcriptional activator II (Gene Name=cII)

[Back to BioLiP]