Structure of PDB 8if1 Chain C Binding Site BS01

Receptor Information
>8if1 Chain C (length=277) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVDGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEP
RAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQM
MFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKW
EAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDH
EATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAV
VVPSGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8if1 Complex structure of HLA-A*24:02 and SARS-Cov-2 epitope NYNYLFRLF with Y453F mutation
Resolution Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 N77 Y84 L95 M97 F99 Y116 T143 K146 W147 V152 Q155 Q156 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)		Y10 E66 K69 V70 H73 N80 Y87 L98 M100 F102 Y119 T146 K149 W150 V155 Q158 Q159 Y162 T166 Y174
Enzymatic activity
Enzyme Commision number ?
External links