Structure of PDB 8i9a Chain C Binding Site BS01

Receptor Information
>8i9a Chain C (length=272) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTL
ADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAI
SLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTT
DNHNRCGYTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQSKTFRVAV
VVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCF
NPFLYALLGKDFRKKARQSIQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i9a Molecular basis of anaphylatoxin binding, activation, and signaling bias at complement receptors
Resolution3.57 Å
Binding residue
(original residue number in PDB)		P99 F164 C172 Y174 R340 Y393 P405 D417 I421
Binding residue
(residue number reindexed from 1)		P83 F148 C156 Y158 R168 Y213 P225 D237 I241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004876 complement component C3a receptor activity
GO:0004878 complement component C5a receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0002430 complement receptor mediated signaling pathway
GO:0002682 regulation of immune system process
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008015 blood circulation
GO:0010575 positive regulation of vascular endothelial growth factor production
GO:0010759 positive regulation of macrophage chemotaxis
GO:0019722 calcium-mediated signaling
GO:0038178 complement component C5a signaling pathway
GO:0045766 positive regulation of angiogenesis
GO:0090023 positive regulation of neutrophil chemotaxis
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0035577 azurophil granule membrane
GO:0035579 specific granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i9a, PDBe:8i9a, PDBj:8i9a
PDBsum8i9a
PubMed37852260
UniProtQ16581|C3AR_HUMAN C3a anaphylatoxin chemotactic receptor (Gene Name=C3AR1)

[Back to BioLiP]