Structure of PDB 8i3n Chain C Binding Site BS01

Receptor Information

>8i3n Chain C (length=152) Species: 4932 (Saccharomyces cerevisiae)

MASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQ
KGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPR
CVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFED
IG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8i3n Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8i3n The crystal structure of rational designed yCD mutant yCD-RQ
• Resolution: 1.73 Å
• Binding residue (original residue number in PDB): H62 C91 C94
• Binding residue (residue number reindexed from 1): H57 C86 C89
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.5.4.1: cytosine deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004131 cytosine deaminase activity
• GO:0008270 zinc ion binding
• GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity
• GO:0016787 hydrolase activity
• GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
• GO:0019239 deaminase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008655 pyrimidine-containing compound salvage
• GO:0019858 cytosine metabolic process
• GO:0034654 nucleobase-containing compound biosynthetic process
• GO:0044206 UMP salvage
• GO:0046087 cytidine metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8i3n, PDBe:8i3n, PDBj:8i3n
• PDBsum: 8i3n
• UniProt: Q12178|FCY1_YEAST Cytosine deaminase (Gene Name=FCY1)