Structure of PDB 8hqy Chain C Binding Site BS01

Receptor Information
>8hqy Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
AVLLPKC
Ligand information
>8hqy Chain S (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HAWTHRLRERKQLVIYEEISDPE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hqy A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		E61 E64 A69 N73 D90 E92 L93
Binding residue
(residue number reindexed from 1)		E49 E52 A57 N61 D78 E80 L81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8hqy, PDBe:8hqy, PDBj:8hqy
PDBsum8hqy
PubMed38177667
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]