Structure of PDB 8gxc Chain C Binding Site BS01

Receptor Information
>8gxc Chain C (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR
GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>8gxc Chain A (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagcguuacguccgaaagucgcauugcacuccgcgacacggcucuuuaa
aaacaaaagga
<<<<<......(((....<<<<<..........>>>>>...>>>>>....
........)))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gxc Structure-based investigations of the NAD+-II riboswitch.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y12 N14 N15 E18 K21 S47 L48 K49 M50 R51 Q53 F55 K79 R82 Q84 Y85 A86 K87 D89 S90 D91
Binding residue
(residue number reindexed from 1)		Y11 N13 N14 E17 K20 S46 L47 K48 M49 R50 Q52 F54 K78 R81 Q83 Y84 A85 K86 D88 S89 D90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8gxc, PDBe:8gxc, PDBj:8gxc
PDBsum8gxc
PubMed36610789
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]