Structure of PDB 8go9 Chain C Binding Site BS01

Receptor Information
>8go9 Chain C (length=185) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIY
SASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFG
QGTKVEIKRTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWK
VSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8go9 Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors
Resolution3.35 Å
Binding residue
(original residue number in PDB)		S31 R67
Binding residue
(residue number reindexed from 1)		S31 R67
External links