Structure of PDB 8gdv Chain C Binding Site BS01

Receptor Information

>8gdv Chain C (length=197) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKFSPEVIPMFSALSCGATPQD
LNTMLNTVGGHQAAIQMLKETINEEAAEWDRLHPEPRGSDIAGTTSTLQE
QIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRD
YVDRFYKTLRAEQSQEVKNAATETLLVQNANPDKTIATLEEMMTACQ

Ligand information

>8gdv Chain O (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPPL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8gdv Structure of M66I mutant of disulfide stabilized HIV-1 CA hexamer in complex with CPSF6 peptide and IP6
Resolution	3.3 Å
Binding residue (original residue number in PDB)	N53 L56 N57 I66 K70 N74 T107
Binding residue (residue number reindexed from 1)	N52 L55 N56 I65 K69 N73 T94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8gdv, PDBe:8gdv, PDBj:8gdv
PDBsum	8gdv
PubMed
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]