Structure of PDB 8gbj Chain C Binding Site BS01

Receptor Information
>8gbj Chain C (length=317) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEAL
ETLQIIRREKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEI
CGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLA
TACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQV
YLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLA
NNHRLAVILTNQMTTLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPS
QKECTVLFQIKPQGFRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gbj Structural insights into BCDX2 complex function in homologous recombination.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		S256 E303
Binding residue
(residue number reindexed from 1)		S233 E272
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008821 crossover junction DNA endonuclease activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000707 meiotic DNA recombinase assembly
GO:0000722 telomere maintenance via recombination
GO:0000724 double-strand break repair via homologous recombination
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0007062 sister chromatid cohesion
GO:0007066 female meiosis sister chromatid cohesion
GO:0007131 reciprocal meiotic recombination
GO:0007141 male meiosis I
GO:0007283 spermatogenesis
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0030054 cell junction
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0033065 Rad51C-XRCC3 complex
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gbj, PDBe:8gbj, PDBj:8gbj
PDBsum8gbj
PubMed37344589
UniProtO43502|RA51C_HUMAN DNA repair protein RAD51 homolog 3 (Gene Name=RAD51C)

[Back to BioLiP]