Structure of PDB 8gak Chain C Binding Site BS01

Receptor Information
>8gak Chain C (length=127) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRP
GGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNA
YLQQVDSNIKGDKITYLVKEQKMQAFS
Ligand information
>8gak Chain D (length=20) Species: 1497372 (Chinavia ubica) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSKPVPIIACNRKTGKCTRI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gak Discovery, characterization, and redesign of potent antimicrobial thanatin orthologs from Chinavia ubica and Murgantia histrionica targeting E. coli LptA.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		T32 Q34 P35 I36 H37 I38 E39 S40 D41 Q43 F54 N57 R76 G82 D119
Binding residue
(residue number reindexed from 1)		T5 Q7 P8 I9 H10 I11 E12 S13 D14 Q16 F27 N30 R49 G55 D92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001530 lipopolysaccharide binding
Biological Process
GO:0015920 lipopolysaccharide transport
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gak, PDBe:8gak, PDBj:8gak
PDBsum8gak
PubMed37416832
UniProtP0ADV1|LPTA_ECOLI Lipopolysaccharide export system protein LptA (Gene Name=lptA)

[Back to BioLiP]