Structure of PDB 8fbw Chain C Binding Site BS01

Receptor Information
>8fbw Chain C (length=231) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLAKPGGSLRLSCAASGFTFSRYAIHWVRQAPGKGLEWVSV
ISSGGSTYYADSVEGRFTISRDNSKNTLSLQMNSLRTEDTAVYYCAKDAT
PYYYSGGYWYVGNYSFDYWGQGVLVTVSSASTKGPSVFPLAPSSRSTSES
TAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTV
PSSSLGTQTYVCNVNHKPSNTKVDKRVEIKT
Ligand information
>8fbw Chain E (length=16) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LKSDKKIEYNETWYSR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fbw Effect of Passive Administration of Monoclonal Antibodies Recognizing Simian Immunodeficiency Virus (SIV) V2 in CH59-Like Coil/Helical or beta-Sheet Conformations on Time of SIV mac251 Acquisition.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
S52 G54 S56 T57 Y58 Y102 W109 Y110 V111 Y114
Binding residue
(residue number reindexed from 1)
S52 G54 S56 T57 Y58 Y102 W109 Y110 V111 Y114
External links