Structure of PDB 8fba Chain C Binding Site BS01

Receptor Information
>8fba Chain C (length=219) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTLSNYGVHWVRQAPGTGLEWVAL
IWYDGSNKFYADSVKGRFTISRDNSMDIVYLQMNNLRAEDTALYYCVRPG
IAAAGSNYYAMDVWGQGTAVTVSSASTKGPSVFPLAPSGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEPK
Ligand information
>8fba Chain Q (length=11) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NVDPNANPNVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fba Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution1.96 Å
Binding residue
(original residue number in PDB)		N31 Y32 G33 W52 Y52A F58 P95 N100C Y100D Y100E
Binding residue
(residue number reindexed from 1)		N31 Y32 G33 W52 Y53 F59 P99 N107 Y108 Y109
External links