Structure of PDB 8fat Chain C Binding Site BS01

Receptor Information
>8fat Chain C (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSVYGMHWVRQAPGKGLEWVAV
IWYDGSNKIYADSVKGRFTISRDNSKNTLYLQMDSLSAADTAVYYCAKIG
SSSFDYWGQGTLVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEP
Ligand information
>8fat Chain F (length=14) Species: 5843 (Plasmodium falciparum NF54) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPNANPNVDPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fat Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.95 Å
Binding residue
(original residue number in PDB)		V31 Y32 G33 W52 Y52A I95 S98 S99
Binding residue
(residue number reindexed from 1)		V31 Y32 G33 W52 Y53 I99 S102 S103
External links