Structure of PDB 8fan Chain C Binding Site BS01

Receptor Information
>8fan Chain C (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNFGMHWVRQTPDRGLEWVAI
IWFDGSNTFYADSVKGRFTISRDNYKNTLYLQMNSLRAEDTAVYFCARSF
YSDSAGSLFDYWGQGTLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLICNVNHKPSN
TKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fan Molecular determinants of cross-reactivity and potency by VH3-33 antibodies against the Plasmodium falciparum circumsporozoite protein
Resolution2.9 Å
Binding residue
(original residue number in PDB)		N31 F32 G33 W52 F52A S95 Y97
Binding residue
(residue number reindexed from 1)		N31 F32 G33 W52 F53 S99 Y101
External links