Structure of PDB 8e3i Chain C Binding Site BS01

Receptor Information
>8e3i Chain C (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAAC
GKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFY
SKFGECSNKECPFLHID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3i Molecular basis for the recognition of the AUUAAA polyadenylation signal by mPSF.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		C68 K69 H70 R73 L75 C76 K77 K78 F84 C96 Y97 F98 C105 S106 F112
Binding residue
(residue number reindexed from 1)		C69 K70 H71 R74 L76 C77 K78 K79 F85 C97 Y98 F99 C106 S107 F113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e3i, PDBe:8e3i, PDBj:8e3i
PDBsum8e3i
PubMed36130077
UniProtO95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 (Gene Name=CPSF4)

[Back to BioLiP]